Protein Info for DvMF_1931 in Desulfovibrio vulgaris Miyazaki F

Annotation: TRAP dicarboxylate transporter, DctM subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 220 to 252 (33 residues), see Phobius details amino acids 264 to 291 (28 residues), see Phobius details amino acids 311 to 339 (29 residues), see Phobius details amino acids 352 to 368 (17 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details amino acids 432 to 453 (22 residues), see Phobius details amino acids 459 to 475 (17 residues), see Phobius details amino acids 495 to 513 (19 residues), see Phobius details amino acids 520 to 544 (25 residues), see Phobius details amino acids 551 to 570 (20 residues), see Phobius details amino acids 576 to 599 (24 residues), see Phobius details amino acids 612 to 635 (24 residues), see Phobius details PF04290: DctQ" amino acids 78 to 191 (114 residues), 103.6 bits, see alignment E=1.2e-33 PF06808: DctM" amino acids 225 to 635 (411 residues), 389.8 bits, see alignment E=2.2e-120 TIGR00786: TRAP transporter, DctM subunit" amino acids 235 to 639 (405 residues), 456.3 bits, see alignment E=4.2e-141 PF03606: DcuC" amino acids 313 to 631 (319 residues), 30.5 bits, see alignment E=2.3e-11

Best Hits

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 100% identity to dvm:DvMF_1931)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DQ10 at UniProt or InterPro

Protein Sequence (640 amino acids)

>DvMF_1931 TRAP dicarboxylate transporter, DctM subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSERNTFSWATANEWLEKPFLVAGLMVMILAITYQTGFRYSMATINEMLNDAGTVAFLAR
FVDVEGLKAGLQRIIGWSVWSEELSRYLFIWISYLAVPLAIMKRSNIRVDVLCAKLPPRA
QGMAWVVVDVCTLVLTGALCYMGFGHVQMQIAMPQTTPAMGIKYFIPYMILPVGFFLMTL
RTVQDLVRQARTMPALDVVGGVACGLLLFLPVLLSDQWSAVWLLFGYFVLFLLVGVPIAF
SLGLATIATVLGAGTLPLEYLAQIAFVSIDSFPILAIPFFIAAGVFMGAGGLSRRLLALG
DELVGALPGGMALATIVTCMFFAAISGSGPATVAAIGSITIPAMVERGYDKFFAAAVVAS
AGCIGVMIPPSNPFVVYGVAAQASVGKLFLAGIVPGVLCGLALMAVAYYISLKKGWRGEA
RHRDFRSVMQAMWEAKWALLVPVIVLGGIYGGIMTPTEAAAVSALYGMIVGLFIYREITW
RRMWDCMVESAQTSSVIIVLMAMATLFGNIMTIEQVPDHIAAMILGVTSNKIAILLLINV
FLLWVGTFMEALAAIVIITPILLPLVTQVGVDPIHFGVIMVVNLAIGFITPPVGVNLFVA
SSISKVSIGDVVRAAWPFLLVMIALLMAITYIPAISLCLL