Protein Info for DvMF_1919 in Desulfovibrio vulgaris Miyazaki F

Annotation: polar amino acid ABC transporter, inner membrane subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 112 (99 residues), 95.8 bits, see alignment E=9.4e-32 PF00528: BPD_transp_1" amino acids 35 to 217 (183 residues), 83.2 bits, see alignment E=1e-27

Best Hits

Swiss-Prot: 54% identical to GLNP_ECOLI: Glutamine transport system permease protein GlnP (glnP) from Escherichia coli (strain K12)

KEGG orthology group: K10037, glutamine transport system permease protein (inferred from 100% identity to dvm:DvMF_1919)

MetaCyc: 54% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPZ8 at UniProt or InterPro

Protein Sequence (223 amino acids)

>DvMF_1919 polar amino acid ABC transporter, inner membrane subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MALDFKASVMWESVPLLLGGVHLTIIITLGGLAIGFLLGTATGLAKTARGKLPRALADIY
VEAIRGTPLIVQVMFLYFGVPLATGMRIPPVTAGIIAIAVNSGAYIAEIVRGAVESIDVG
QTEAGRSIGLTRMQTLLYVVWPQAFRRMIPPLGNQFIISLKDTSLLVVIGVGELTRQGQE
IIAVNFRAFEVWLTVAVMYLVMTLSIARALRVYERKLNARSGR