Protein Info for DvMF_1900 in Desulfovibrio vulgaris Miyazaki F

Annotation: 3-deoxy-manno-octulosonate cytidylyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 36% identical to KDSB_CHLPD: 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB) from Chlorobium phaeobacteroides (strain DSM 266)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 100% identity to dvm:DvMF_1900)

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

CMP-3-deoxy-D-manno-octulosonate biosynthesis (5/5 steps found)
superpathway of (Kdo)₂-lipid A biosynthesis (11/17 steps found)
superpathway of Kdo₂-lipid A biosynthesis (11/25 steps found)

KEGG Metabolic Maps

Lipopolysaccharide biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.38

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMJ9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>DvMF_1900 3-deoxy-manno-octulosonate cytidylyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MNIVAIIPARMGSSRFPGKPMADIHGVPMVGHVTFRTAMSPTLTATYVATCDQEIYDYAE
SAGLKAVMTGDHHVRCTTRTAEALLKIEAATGKRVDIVVMVQGDEPMVTPDMIDAAIAPM
LADPAINVTNLMARMETVEEFEDPNEVKVVVDLNSDALYFSREPVPSRKKGVTDVPMQKQ
VCIIPFRRDYLLKFNDMQETPLEIIESVDMMRILEHGEKVRMVPTDKRTLSVDTPEDLAR
VVDMMAEDTLRLVYTK