Protein Info for DvMF_1899 in Desulfovibrio vulgaris Miyazaki F

Annotation: NAD-dependent epimerase/dehydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 175 (175 residues), 30.6 bits, E=7.5e-11
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 243 (238 residues), 94.9 bits, E=2.7e-30
• PF01370: Epimerase
  • amino acids 6 to 205 (200 residues), 156.1 bits, E=4.3e-49
• PF01073: 3Beta_HSD
  • amino acids 6 to 118 (113 residues), 58.7 bits, E=2e-19
• PF13460: NAD_binding_10
  • amino acids 7 to 158 (152 residues), 60.6 bits, E=7.5e-20
• PF02719: Polysacc_synt_2
  • amino acids 38 to 237 (200 residues), 41.3 bits, E=4.6e-14

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to dvm:DvMF_1899)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase"

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See B8DMJ8 at UniProt or InterPro

Protein Sequence (304 amino acids)

>DvMF_1899 NAD-dependent epimerase/dehydratase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKITFFGGAGFLGSHVCDKLSDAGHEVTIVDLRPSPYLRSDQRMVVGNILDEAAVDAAIA
GADAVFNFAGIADIGEANRKPVDTARINVLGNVILLEACRKAKVSRYVFASSLYVYGKSG
GFYRCSKQACELYIENYQAMHGLDYTILRYGSLYGPRADRRNAINRFVAEALETGAITYY
GSPTALREYIHVEDAALCTVEVLKPEYANENIVLTGNQPMRVGDLFKMIGEMLGKELNIA
YQHDPNSGHYQVTPYAFMPKVGKKLVPNLTTDLGQGVLRVMEEVHRELHPDMHNVGGYLL
PREE