Protein Info for DvMF_1898 in Desulfovibrio vulgaris Miyazaki F

Annotation: HpcH/HpaI aldolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03328: HpcH_HpaI
  • amino acids 18 to 243 (226 residues), 111 bits, E=2.7e-36

Best Hits

KEGG orthology group: K01630, 2-dehydro-3-deoxyglucarate aldolase [EC: 4.1.2.20] (inferred from 100% identity to dvm:DvMF_1898)

Predicted SEED Role

"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)

MetaCyc Pathways

• D-glucarate degradation I (2/4 steps found)
• D-galactarate degradation I (2/4 steps found)
• superpathway of D-glucarate and D-galactarate degradation (2/5 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (6/31 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.20 or 4.1.2.n4

Sequence Analysis Tools

See B8DMJ7 at UniProt or InterPro

Protein Sequence (259 amino acids)

>DvMF_1898 HpcH/HpaI aldolase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MITARDIREKMRRGEATIGTWMQIPSTDVAEILGRSGYDWVAVDLEHAAFTRSQLPDAFR
AIELGGAAPFARVAEATLTDIKASLDSGARGLIFPMIETREQLDAAIGWALYPRTDGPSG
VRGVGYCRANLFGREFTPYVNETARDTLFVAQIEHIRAVDNLDAILSHPRLDAIMVGPYD
LSGSMGLTAQFDHPDFLAALDRIAAAARAHDVPMGLHIVQPDTADLARRIGEGYRFIAWC
IDAVFLYRNCACPPAGGAA