Protein Info for DvMF_1890 in Desulfovibrio vulgaris Miyazaki F

Annotation: iron-containing alcohol dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF00465: Fe-ADH" amino acids 11 to 303 (293 residues), 186.2 bits, see alignment E=4.2e-59

Best Hits

Swiss-Prot: 48% identical to KDNB_SHEON: 3-deoxy-alpha-D-manno-octulosonate 8-oxidase (kdnB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1890)

MetaCyc: 48% identical to 3-deoxy-D-manno-octulosonate 8-oxidase (Shewanella oneidensis MR-1)
RXN-16746 [EC: 1.1.3.48]

Predicted SEED Role

"alcohol dehydrogenase, iron-containing"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMI9 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DvMF_1890 iron-containing alcohol dehydrogenase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MYRNTKNVPFYILGKGSFAQLGDLVDARRAAVAGPAVFFVDHFFRGRELEGRLPKKDGDL
VLFVDTTSEPTTEQIDDFAAATRAHDNRLPCTVVAIGGGATLDVGKAVANMLTNPGQAAD
YQGWDLVKNPAPHKIGVPTLSGTGAECSRTCVLLNAKRGIKLGMNSDITMYDQLLLDPEL
TRTVPRDQYFYTGMDTYMHCIESLRGSYRNVIVDALAQKAVDMCEEIFLSDDMMAEENLE
KMMIASYLGGMSAGNVGVIHPISAGLSVVLHTHHGIANCYALSVLGEFYPEDYPKYARMI
ERQGVNLPKGLCANLSDDQLKALVASSVVHEKPLTNALGPDFRKILTDEKVISLFKAM