Protein Info for DvMF_1881 in Desulfovibrio vulgaris Miyazaki F

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 196 to 216 (21 residues), see Phobius details PF02203: TarH" amino acids 4 to 157 (154 residues), 37.5 bits, see alignment E=4.6e-13 PF12729: 4HB_MCP_1" amino acids 8 to 191 (184 residues), 75.6 bits, see alignment E=7.8e-25 PF00672: HAMP" amino acids 216 to 256 (41 residues), 22.2 bits, see alignment 3e-08 PF00015: MCPsignal" amino acids 374 to 556 (183 residues), 167.8 bits, see alignment E=4.2e-53

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to dvm:DvMF_1881)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMI0 at UniProt or InterPro

Protein Sequence (592 amino acids)

>DvMF_1881 methyl-accepting chemotaxis sensory transducer (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKFLRQFGITTRLVVLSLLAFFFIGAAGMAGWMGARVIQENLKDVSNVRLPGLNFLIQAD
RDLQQLLVAERSLLFADPADKKLIERLKKEYEDNLRQSDERWNKYKKLPLDEPARPLIPQ
YDAARATWMPLSRAVVDAALSGDPAARQKAAASSLGDVGVKFEAMREVINQLTEIIEQAA
KADNAEADASYDDTMFRLAGATTLALLVLAGFAIAITRSVTVPLKRTVAYSEAVSRGALE
ECLAVDARDEVGVLAECLCRMVSTLKDKIGEADSRSAEARAESERARQASAEAEAARRMA
ESAKRDGMLHAADTLTGVTGVLGSASEELAAQIEQASRGAEHQMQRVSETATAMEEMNAT
VLEVARSAGEAAGSAESARDKAVSGQDVVRQVVAGIGQVQQTADQLKADMAELGRQAEDI
GRVMTVINDIADQTNLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMLATKEVGQAI
AGIQSGTRRNVGHVEDTVQHVQQVTRLATESGESLGVIVDLAASVSDQVRSIATASEEQS
AASEEINRSIEDISRVSAESAEVMRQSAVAVAEMAQQTHVLQGLIRKMREDG