Protein Info for DvMF_1828 in Desulfovibrio vulgaris Miyazaki F

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 10 to 11 (2 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 290 to 315 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 97 (97 residues), 40.1 bits, see alignment E=3.8e-14 PF00528: BPD_transp_1" amino acids 113 to 320 (208 residues), 131.6 bits, see alignment E=3e-42

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to dvm:DvMF_1828)

Predicted SEED Role

"Peptide ABC transporter, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMC8 at UniProt or InterPro

Protein Sequence (325 amino acids)

>DvMF_1828 binding-protein-dependent transport systems inner membrane component (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MFAFIVRRVAQALLVMFIISFIGFAIKQSVGDPTREMVGVSVSVKEREALREKLGLNDPY
LVQWARFTKNAVQGDLGTSYFYRKPALDVILAKAPATLELVFVAQCIIVLISVPVGVYSA
CRPRSVLSRLFMGISIVGVSVPVFLTAIFMIYIFSVHLGWLPSFGRGNPVEIFPGWTSVL
TTWSNFKHIILPSIALSSIMLPLFIRLIRAEMKEALETEYVKFARAKGLPEWRVVMVHAF
KNTLLPVITVGGVQLGIMIAFTILTETVFQWQGMGFMFVEAVERADTALLVAYLIFVGAI
FVTVNTVVDLIYGFVNPMVRIAGRK