Protein Info for DvMF_1808 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF1078 domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 TIGR03506: flagellar hook-basal body protein" amino acids 3 to 481 (479 residues), 291.6 bits, see alignment E=6.4e-91 PF00460: Flg_bb_rod" amino acids 5 to 35 (31 residues), 32.4 bits, see alignment (E = 1.1e-11) PF07559: FlaE" amino acids 201 to 380 (180 residues), 73.3 bits, see alignment E=4.2e-24 PF06429: Flg_bbr_C" amino acids 421 to 498 (78 residues), 63.2 bits, see alignment E=2.8e-21

Best Hits

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 100% identity to dvm:DvMF_1808)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMA8 at UniProt or InterPro

Protein Sequence (501 amino acids)

>DvMF_1808 protein of unknown function DUF1078 domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MLRALYSGATGMKTLAQGMQAVSNNLANVNTVGFKQQQALFEDLMSQYAGTGNSASTSIS
QVGLGSRLTDIRTVYGQGSYESGTDITDLSINGKGFFQVSLGGKTHYTRAGNFRFDKGGN
LVDPNGFVLNGRAITNGVEGATGPISLPPGADGRNVMPAKATTSITALNNLGSGDRSSDA
ANPYFSLLSKWNGTAQSPLGDSAYTYKQSIKVYDATGNAHDVTIYFDGAGQSGGNKHFEF
VVSMDPAHDGSGMAGTSAAGLLMSGTLTFNSSGQLVNMSAYTPTGTDATNLSNWAPASFG
ADGLPQFTATFASGGGTQVVGLDLGLTSSTGAWTAGAGSPAAVGSNASNLMGMGGATLAA
VSTTAYGGSSSEIRSKQDGYAQGFLAGIDISADGIITGRYSNGQNDDLYHITLYRFTSED
GLRREGMNHFSATLESGAAQEGLPDTQNYGTVAAKSLEQSNVSMEREFVNMIIYQRGFQT
NSKSIMTADSMIQKALELKRT