Protein Info for DvMF_1800 in Desulfovibrio vulgaris Miyazaki F

Annotation: phage shock protein B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details PF06667: PspB" amino acids 21 to 82 (62 residues), 27.7 bits, see alignment E=1.1e-10 TIGR02976: phage shock protein B" amino acids 21 to 85 (65 residues), 59.3 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: K03970, phage shock protein B (inferred from 100% identity to dvm:DvMF_1800)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DMA0 at UniProt or InterPro

Protein Sequence (107 amino acids)

>DvMF_1800 phage shock protein B (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHEPYMFEEIFAVMAQLGPVMMFWFMVLPALVAVLLLAILYRLLRTREGATPAHDDETRM
IQEMYRAMGRMEERVEALETLLLDPDGTAGRARHDAGRDALRGPGRE