Protein Info for DvMF_1798 in Desulfovibrio vulgaris Miyazaki F

Annotation: sigma54 specific transcriptional acivator, PspF, Fis family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF14532: Sigma54_activ_2" amino acids 17 to 187 (171 residues), 54 bits, see alignment E=7e-18 PF00158: Sigma54_activat" amino acids 17 to 178 (162 residues), 194.1 bits, see alignment E=4.5e-61 PF07728: AAA_5" amino acids 39 to 157 (119 residues), 26.4 bits, see alignment E=1.9e-09 PF25601: AAA_lid_14" amino acids 188 to 249 (62 residues), 62.9 bits, see alignment E=6.2e-21 PF02954: HTH_8" amino acids 388 to 421 (34 residues), 24.7 bits, see alignment 4.9e-09

Best Hits

KEGG orthology group: K03974, psp operon transcriptional activator (inferred from 100% identity to dvm:DvMF_1798)

Predicted SEED Role

"Psp operon transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM98 at UniProt or InterPro

Protein Sequence (434 amino acids)

>DvMF_1798 sigma54 specific transcriptional acivator, PspF, Fis family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHDSTRAVASPALAEAIGQSDAFLAFQEALSRVARVDRPVLLAGERGTGKELAAARLHYL
SPRWQGPLVVLDCAALAPTLAEAELFGHEAGAFTGAAARRAGRFERADGGTLFLDEVGNI
PAGVQDKLLRVVEYGMLERVGGTQPVRVDARVVAATNADLPAMVARGLFRADLLDRLSFE
VLAVPPLRERGDDVILLARHFAASMAAELDLPDTPELAPAALAQLLAHPWPGNVRELRNA
VERAVARLDEGGMRTGDRRRESAGAGGARPAGRAPRIEHFDLDPFARPWRQGPAVPRSAP
ATQPPPSTGAMADGAGPRRGPGTVPPDAARPYGTSPHDARPVNISPDNAGPDSVGPVSVG
PDNAHRGAVGAPSAIGPPLPGMPLPEAIRQLELSALRAALDRARHNRRVAAELLGISYDQ
FRGLYRRHRQDMET