Protein Info for DvMF_1750 in Desulfovibrio vulgaris Miyazaki F
Annotation: 3-dehydroquinate synthase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to DHQS_METPE: 3-dehydroquinate synthase (aroB') from Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
KEGG orthology group: K11646, dehydroquinate synthase II [EC: 1.4.1.-] (inferred from 100% identity to dvm:DvMF_1750)Predicted SEED Role
"3,7-dideoxy-D-threo-hepto-2, 6-diulosonate synthase (EC 4.2.3.-)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.-)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (17/18 steps found)
- superpathway of L-tryptophan biosynthesis (12/13 steps found)
- superpathway of L-phenylalanine biosynthesis (9/10 steps found)
- superpathway of L-tyrosine biosynthesis (9/10 steps found)
- chorismate biosynthesis I (6/7 steps found)
- 3-dehydroquinate biosynthesis I (1/2 steps found)
- superpathway of chorismate metabolism (31/59 steps found)
KEGG Metabolic Maps
- Biosynthesis of terpenoids and steroids
- Cysteine metabolism
- Monoterpenoid biosynthesis
- Phenylalanine, tyrosine and tryptophan biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.4.1.- or 4.2.3.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B8DM51 at UniProt or InterPro
Protein Sequence (323 amino acids)
>DvMF_1750 3-dehydroquinate synthase (RefSeq) (Desulfovibrio vulgaris Miyazaki F) MRTILFKSVPFDKGLVTLALESGVDGIIVPRAQVDSVATLARCRVLADEDVATIALSAKA DEEEAAARLARGETVVLERGWEIIPVENLLAQSDDVAVEVADLSEARLAAGILERGVATV VVLPEGAGELKSIVADLKLSQGCMDLAPAVVTAVENVGLGHRVCVDTMSMLRRGQGMLVG NSSAFTFLVHAETEHNEYVAARPFRINAGAVHAYAQMPGDRTTYLEELRAGDEVLIVSAD GSTTVATVGRLKMEARPMLLVRAKVGDVEGAVFLQNAETIRLTRPDGTPVSVVSLKEGDQ ILCRTDCAGRHFGMRIKEDIKEC