Protein Info for DvMF_1700 in Desulfovibrio vulgaris Miyazaki F

Annotation: PAS/PAC sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 TIGR00229: PAS domain S-box protein" amino acids 221 to 348 (128 residues), 30.5 bits, see alignment E=1.8e-11 PF08448: PAS_4" amino acids 233 to 343 (111 residues), 41.2 bits, see alignment E=3.6e-14 PF13426: PAS_9" amino acids 238 to 340 (103 residues), 28.7 bits, see alignment E=2.6e-10 PF00512: HisKA" amino acids 359 to 422 (64 residues), 48 bits, see alignment E=2.2e-16 PF02518: HATPase_c" amino acids 465 to 567 (103 residues), 94.1 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1700)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DM02 at UniProt or InterPro

Protein Sequence (591 amino acids)

>DvMF_1700 PAS/PAC sensor signal transduction histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTTQPPSGPSVPPAPTPESGNASPRRSAGCPACAPVHAPERNPAHDPAHDPGHAGQAQTD
GHAAPRRPFPVALAGVGRALRPVAGLLQRPDFLLGFPWVHLTGMLLTPQDHDDLVQHACQ
PLSAPGAPPPPDPAALEARAGLPPAPPAPGGVPRFAAAADLFAAQPGLRMVIDLTDDGRH
MAELRAAAPDGVSLLDAGGALWVWEMLASEKLCSTCNLHLREARDLFATLIDQVDEDILL
LDTEGRIVDLNRNILQRKGGTKDDWIGTCCWQLDGASFCCPPEHGGCTFRETVSTGHKAE
RIHTRVNDDGRVQYFRVYTYPVTDDAGRLTRVIEMRRDITNRTNMEIRLQQAEKMAAIGE
LSTYVAHEIRNPLFAIGGFANSLLRSPSLDEAARGKVQVILEESRRLDTILKSILNFARP
TSPRTGEVDLNLLARQTMELMSMGFDQRRITVDMQLAPDIPKAHGDGEMLKQCLINLVKN
AQEAMPAGGRLTVRTGMNQQHVHIAVADTGVGIPPELHDKIFSPFFSTKEKGAGIGLAMS
RKIIEEMGGRVDLQSQVGKGTTITLHLLPLLAVPRTTEPARDDPAGDGMKG