Protein Info for DvMF_1693 in Desulfovibrio vulgaris Miyazaki F

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details transmembrane" amino acids 350 to 370 (21 residues), see Phobius details amino acids 417 to 439 (23 residues), see Phobius details amino acids 459 to 480 (22 residues), see Phobius details amino acids 506 to 523 (18 residues), see Phobius details amino acids 543 to 561 (19 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 14 to 44 (31 residues), 17.4 bits, see alignment (E = 2.2e-07) PF12838: Fer4_7" amino acids 75 to 168 (94 residues), 40.3 bits, see alignment E=6.9e-14 PF13247: Fer4_11" amino acids 148 to 251 (104 residues), 47.8 bits, see alignment E=2.9e-16 PF13237: Fer4_10" amino acids 177 to 244 (68 residues), 34.5 bits, see alignment E=3.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1693)

Predicted SEED Role

"iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DLZ5 at UniProt or InterPro

Protein Sequence (591 amino acids)

>DvMF_1693 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTTRTSHAASPRRLSRRGFLKGLAGTGFAGSASLATGMFPSTAEGAGVGGNTSAPSGRGA
SGNDGPLATLIDISACVGCGACVQACRERNAARYPEPRKPFPPMFPASVKAEDWSARRDT
DDRLTPYNWLYIQNVTVQHGGHQVELNIPRRCLHCDNPPCANLCPWGAARREASGTVSID
ADICLGGAKCRTVCPWQIPQRQTGVGLYLNLLPRYAGNGVMYKCDRCADVVARGGTPACM
EACPNAVQSIGPRNAIIAQARRLAAERGGHLYGLDENGGTSTIYLSPVPFTAIQAALEAA
TTAAKPVSMQDGKQDGGQDTGKAPAQASATLGPGRPHFRAVGDAMRGETMLAAALVTAPL
AGAGAALLRVARGISDMASANANDPGAPNASTTAGTPGTTGIPDAASPAHPRPVARWLWI
ACATVLGVTGMAQMPIAARYGIAAVPGLAWTADFHFTHLLHYGGAAVLLALSAWLAVRAL
AGPRIRRLFAAHPLPTPYRLTGGGRLRLWLVAALIVTGGMRVAKNLPGFDWGPTLTMYLD
WTHLGLAGLLGMASLALALTGRSAWTAPVPASRSAARPAPPDHHPEHPPRA