Protein Info for DvMF_1628 in Desulfovibrio vulgaris Miyazaki F

Annotation: efflux transporter, RND family, MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF16576: HlyD_D23" amino acids 50 to 272 (223 residues), 44.6 bits, see alignment E=1.6e-15 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 60 to 267 (208 residues), 104.9 bits, see alignment E=2.1e-34 PF13533: Biotin_lipoyl_2" amino acids 64 to 111 (48 residues), 45 bits, see alignment 1.1e-15 PF13437: HlyD_3" amino acids 188 to 273 (86 residues), 28 bits, see alignment E=4.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1628)

Predicted SEED Role

"secretion protein HlyD family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DS37 at UniProt or InterPro

Protein Sequence (383 amino acids)

>DvMF_1628 efflux transporter, RND family, MFP subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRRNIILAYVLPALALAGLAAGVVHASRTSAPPAPVPPVADPAAPPYERYISGSGIVEAA
SRDVGVATPTSGVIVEIPVTVGDAVRKGDMLFRLDDRERKAALAQQRAALAVARARVAEA
RVALEKARADAARVRSLRDGRAVSAEEAAQRGYAEDAARTALASATADAAQAEAAARAIE
VDLDRLCVRAPMDATVLQVNVSEGEYATAGALSTPLVMLGDVSRLHVRVDIDENIAWRYR
AGMPATVFLRGNRDFSAPLRFVRVEPYVLPKTSLTGDTTERVDIRVLQVLYAFDVRDMPA
YVGQQVDVYFDDTGPRAGIGPAAGGMARMGDDAPGSTGRVGEAGAVAVERSAVGGAMPEV
VVPVRDLKKGAGSRISADAGVRG