Protein Info for DvMF_1598 in Desulfovibrio vulgaris Miyazaki F

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12800: Fer4_4
  • amino acids 64 to 76 (13 residues), 14.3 bits, see alignment (E = 2.2e-05)
  • amino acids 125 to 139 (15 residues), 18.2 bits, see alignment (E = 1.3e-06)
• PF12838: Fer4_7
  • amino acids 64 to 140 (77 residues), 41.1 bits, E=1e-13
• PF00037: Fer4
  • amino acids 64 to 81 (18 residues), 21.3 bits, see alignment (E = 8.9e-08)
  • amino acids 121 to 142 (22 residues), 30.2 bits, see alignment (E = 1.4e-10)
• PF13534: Fer4_17
  • amino acids 64 to 140 (77 residues), 24.8 bits, E=1.3e-08
• PF13187: Fer4_9
  • amino acids 64 to 140 (77 residues), 27 bits, E=1.8e-09
• PF13183: Fer4_8
  • amino acids 64 to 140 (77 residues), 33.3 bits, E=3e-11

Best Hits

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 100% identity to dvm:DvMF_1598)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (2/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See B8DS07 at UniProt or InterPro

Protein Sequence (207 amino acids)

>DvMF_1598 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MASIFRTLADLWSLVVGLGITGKEFCKPGVTVHYPRAEVTPEAAASFRGPIELIGLDKDP
AKPKCIACMLCVSACPSNCITVTRAPTPKPTPEELKAMAEAEARGEKPKKPAPPKAPGTW
TYDFSLCSLCGSCVEACPVDSIGFSHDIYMVGTKREDFVFDQLARLARKAAARKPEPKPA
AKVAPGAAPETPAPAPETAAATPASEA