Protein Info for DvMF_1597 in Desulfovibrio vulgaris Miyazaki F

Annotation: NADH dehydrogenase (quinone) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00146: NADHdh
  • amino acids 17 to 319 (303 residues), 378.2 bits, E=1.5e-117

Best Hits

Swiss-Prot: 54% identical to NUOH1_SYNFM: NADH-quinone oxidoreductase subunit H 1 (nuoH1) from Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to dvm:DvMF_1597)

MetaCyc: 40% identical to NADH:quinone oxidoreductase subunit H (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to dimethyl sulfoxide electron transfer (2/2 steps found)
• NADH to fumarate electron transfer (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NADH to hydrogen peroxide electron transfer (1/2 steps found)
• NADH to trimethylamine N-oxide electron transfer (1/2 steps found)
• nitrate reduction VIII (dissimilatory) (1/2 steps found)
• Fe(II) oxidation (2/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

See B8DS06 at UniProt or InterPro

Protein Sequence (324 amino acids)

>DvMF_1597 NADH dehydrogenase (quinone) (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MNATISFDSVLHVVLALVGVAVFVGLNGLLLVYAERKVAGFIQRRPGPYEVGPQGILQAV
ADALKLIGKQLVRPDRADPLLFWMAPVLAFFPVLLLFLPIPFSPLLTGWDVNLGLLLILA
FAGFNVLALLLAGWGSNNKYGLLGAARAVAQSVAYEIPLLLAVLAIAFQEGTLSLTAIVG
GQGGMPWQWNIAVQPLAFLIFFVSALGETNRAPFDLPEAESELTAGFHTEYSGMGFGMFF
LAEYANMIVACSVCTVLFLGGWKGPFLDGAWWFLAKVYGLLLSMMWFRWTYPRVRFDQLL
NLNWRWLLPLGVLNLLATAFVMKL