Protein Info for DvMF_1597 in Desulfovibrio vulgaris Miyazaki F

Annotation: NADH dehydrogenase (quinone) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF00146: NADHdh" amino acids 17 to 319 (303 residues), 378.2 bits, see alignment E=1.5e-117

Best Hits

Swiss-Prot: 54% identical to NUOH1_SYNFM: NADH-quinone oxidoreductase subunit H 1 (nuoH1) from Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to dvm:DvMF_1597)

MetaCyc: 40% identical to NADH:quinone oxidoreductase subunit H (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DS06 at UniProt or InterPro

Protein Sequence (324 amino acids)

>DvMF_1597 NADH dehydrogenase (quinone) (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MNATISFDSVLHVVLALVGVAVFVGLNGLLLVYAERKVAGFIQRRPGPYEVGPQGILQAV
ADALKLIGKQLVRPDRADPLLFWMAPVLAFFPVLLLFLPIPFSPLLTGWDVNLGLLLILA
FAGFNVLALLLAGWGSNNKYGLLGAARAVAQSVAYEIPLLLAVLAIAFQEGTLSLTAIVG
GQGGMPWQWNIAVQPLAFLIFFVSALGETNRAPFDLPEAESELTAGFHTEYSGMGFGMFF
LAEYANMIVACSVCTVLFLGGWKGPFLDGAWWFLAKVYGLLLSMMWFRWTYPRVRFDQLL
NLNWRWLLPLGVLNLLATAFVMKL