Protein Info for DvMF_1593 in Desulfovibrio vulgaris Miyazaki F

Annotation: NADH-ubiquinone/plastoquinone oxidoreductase chain 3 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 43% identical to NU3C_SYNR3: NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) from Synechococcus sp. (strain RCC307)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 100% identity to dvm:DvMF_1593)

MetaCyc: 40% identical to ferredoxin-quinone oxidoreductase subunit C (Parasynechococcus marenigrum WH 8102)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

aerobic respiration I (cytochrome c) (3/4 steps found)
aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
Fe(II) oxidation (2/6 steps found)
NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DS02 at UniProt or InterPro

Protein Sequence (126 amino acids)

>DvMF_1593 NADH-ubiquinone/plastoquinone oxidoreductase chain 3 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MVFDILHLAIILFLIAGLAFAGGPLILAMLVAPRARGGDLGMSYECGMRPHGNAWTRFGI
NYYVYALLFIAFDVDVLYLFPAAAHYHTTVGWTAFIEICVFLFFLVLALVYFRAKGVFTW
PRKIAL