Protein Info for DvMF_1522 in Desulfovibrio vulgaris Miyazaki F

Annotation: NADH-ubiquinone oxidoreductase chain 49kDa (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00374: NiFeSe_Hases
  • amino acids 42 to 110 (69 residues), 46.4 bits, E=3e-16
• PF00346: Complex1_49kDa
  • amino acids 119 to 282 (164 residues), 148.2 bits, E=2.5e-47
  • amino acids 286 to 358 (73 residues), 56.8 bits, E=1.9e-19

Best Hits

Swiss-Prot: 41% identical to MBHLA_PYRFU: Membrane-bound hydrogenase subunit alpha (mbhL) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1522)

MetaCyc: 55% identical to Ech hydrogenase 39 kDa subunit (Methanosarcina barkeri)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"Energy-conserving hydrogenase (ferredoxin), subunit E" in subsystem Energy-conserving hydrogenase (ferredoxin)

MetaCyc Pathways

• hydrogen production VI (2/2 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (6/9 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

See B3VS74 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DvMF_1522 NADH-ubiquinone oxidoreductase chain 49kDa (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSRTIIPFGPQHPVLPEPLHLKLVVEDETIVEAIPALGYVHRGLETLASIRDYNQMVYIV
ERVCGICSCIHAMCYCQGLETMMNVEVPSRAKYLRVIWSELHRIHSHLLWLGLFADGFGF
ESLFMQFWKIRERVMDINEATAGNRVVISVNVVGGVRRDLDKTQQRWILDELDKLEKELR
QLMKTMLDDYTVKKRTVGVGVLTAEQAIQLGAVGPTLRGSGVAQDARQLGYAAFDELDFE
PVTSPEGDSWARSKVRFMETLQSMDIVRQAISRLPDSELAAKVPGKPTGEVVCRVEQPRG
ELLYYLKGNGSKNMERVRIRTPTFANIPPLLAMLPGAQLADVPIAALTIDPCISCTER