Protein Info for DvMF_1514 in Desulfovibrio vulgaris Miyazaki F

Annotation: diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 60 to 79 (20 residues), see Phobius details amino acids 102 to 129 (28 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 200 to 331 (132 residues), 97 bits, see alignment E=4.9e-32 PF00990: GGDEF" amino acids 203 to 335 (133 residues), 107.2 bits, see alignment E=3.8e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1514)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DLT6 at UniProt or InterPro

Protein Sequence (385 amino acids)

>DvMF_1514 diguanylate cyclase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MNHTTSCNTGASGSVGSSGATRAANSVSASGLGLIKHRWLRRPIDAFWRGVDALNPRTRL
AIALFLVIAVPAGVLLHHLESQGRAVLPGLPRALPMSIYDDVVLAVALYLAGALVLCIPV
AGLICRFVLLRDIREINAFCLALREGRQPRPLSLPNEQEDEHDLLRLKRNLEWMAHLVAS
RERHLMARLEATDSRARHMEELAVRDALTGLFNRRHFERRLAELAADARLRPPFHLMLVD
CDRFKAVNDTHGHAAGDELLRLLGDVIAEAVRAGTDTPCRIGGDEFGILFACPDENSVRA
VAERIRLRFSQCQNHGCTLSIGIARYRQQGEGRADAACQLAPVTDAGNAACAGEGAPLAV
QAMVARADGAVYAVKRRGGDGIAVR