Protein Info for DvMF_1497 in Desulfovibrio vulgaris Miyazaki F

Annotation: transport system permease protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 124 to 150 (27 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 284 to 311 (28 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details PF01032: FecCD" amino acids 37 to 374 (338 residues), 283.8 bits, see alignment E=7.4e-89

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to dvm:DvMF_1497)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DLR9 at UniProt or InterPro

Protein Sequence (387 amino acids)

>DvMF_1497 transport system permease protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHNATAPRSVPPQAWAGAARPRRTLRIILLAALCWAATVVLACLFGPFHIAVGDVLRALA
ELALPGGLADGAGATPDATHMLVVTRIRLARVCLALLAGGGLAVAGTVFQGVLRNPLADP
FTLGVSGGAAFGASLALTLGIGPLAAWLTMHLPAFAALSPQALLPLAALAGALASLGAVL
LLGGAAGGGFRRETVVLAGVVVSTVLSALVSLVKALDEESVSSIVFWIMGSLQGRGWAHA
AVLLPWLALGLLLVLPRFRELDILALGDVQARQLGMDTARVRLQLLVGASLITAGCVAVS
GVIGFVGLVVPHLARMRLGAAHGPLLAAGWFGGGVLLAWADVLARTLLPGGAELPVGVVT
ALLGGPFFCLLLVRGGRGAAVRTGGTP