Protein Info for DvMF_1477 in Desulfovibrio vulgaris Miyazaki F

Annotation: diguanylate cyclase with PAS/PAC sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 730 TIGR00229: PAS domain S-box protein" amino acids 47 to 164 (118 residues), 51.7 bits, see alignment E=9.6e-18 amino acids 289 to 409 (121 residues), 73 bits, see alignment E=2.4e-24 PF13426: PAS_9" amino acids 59 to 156 (98 residues), 34.1 bits, see alignment E=8.6e-12 amino acids 310 to 401 (92 residues), 27.6 bits, see alignment E=8.9e-10 PF08448: PAS_4" amino acids 61 to 159 (99 residues), 28.5 bits, see alignment E=4.6e-10 amino acids 298 to 404 (107 residues), 41.7 bits, see alignment E=3.6e-14 PF08447: PAS_3" amino acids 192 to 281 (90 residues), 66 bits, see alignment E=9.3e-22 amino acids 317 to 388 (72 residues), 57.4 bits, see alignment E=4.3e-19 amino acids 440 to 513 (74 residues), 35.7 bits, see alignment E=2.6e-12 PF00989: PAS" amino acids 292 to 355 (64 residues), 32.8 bits, see alignment E=1.8e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 547 to 708 (162 residues), 169.2 bits, see alignment E=6.6e-54 PF00990: GGDEF" amino acids 550 to 706 (157 residues), 157 bits, see alignment E=1.1e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1477)

Predicted SEED Role

"diguanylate cyclase with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DLP9 at UniProt or InterPro

Protein Sequence (730 amino acids)

>DvMF_1477 diguanylate cyclase with PAS/PAC sensor (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSPGSPGSPDASDSPDSPGYSDAPLSPGPFAAPACDPPAPPSFGVSLYEQLFRYHSAVML
LVDAETGCIIEGNPAASTFYGYPDGALCGMSINDIANLGPEEQARRLAELREGRLTCFTS
RHRLASGEVRDVEVHSVPVRLFERTLLYTIIHDITDRVRAEEALRRSEQHLEMVMDGAGI
GSFSWHALTDEVACDTRWGEVLGLGRVECAPMMESWRNMVHPDELPGLERARRRHLSGFT
PRYEAEYRVQGADGAWRWIQETGQVVERDGDGLPLRVAGIVCDVSVRRRAEEDRRRLFNL
SPDLMCVGGVDGYFRELNPAWQEVLGWSREELLDRPWAALVHPDDRASTMQDMDTLRERG
VITNVENRYQCRDGTWRWISWNSAFVPEQGLIYGVGRDVTALRRMVEELRTSEARLRAMA
ATVPGVVLQWREVPGDRQFTYVSPRSREILGVPPEWLLQDWRALPVHPADRTVWELSLRD
AMERRGDWMFEGRLVLPGGEVRWWRGEARPVHGGQSGAAELPEESGIVYCGIITDTTEHR
EAQERLRQLATTDGLTGLANRRRFLEALEHEVQRHRRYGTPLALISIDVDRFKRVNDTWG
HAVGDEVLRALAGICRAEVRDVDTVGRIGGEEFAVLLPDTAPEEAMAVAERLRAGVEAAP
LLTTAGPLTVTLSLGVSASPPCDGADTLLREADRALYRAKAGGRNRVERAFDLAGACATG
DDVDTLLTIP