Protein Info for DvMF_1438 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function UPF0016 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 101 to 115 (15 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details PF01169: UPF0016" amino acids 6 to 81 (76 residues), 73.7 bits, see alignment E=6.4e-25 amino acids 105 to 179 (75 residues), 86.5 bits, see alignment E=6.4e-29

Best Hits

Swiss-Prot: 48% identical to MNEA_VIBC3: Putative manganese exporter (mneA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1438)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DRU9 at UniProt or InterPro

Protein Sequence (195 amino acids)

>DvMF_1438 protein of unknown function UPF0016 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MEAFIAAFGMVAIAEMGDKTQLLSFVLATRFCGRQWPIICGIFVATVANHFCAAYVGEWV
SANIGPDMLRWGLGLAFLAFAVWALIPDKLESEGECKTRESAFLSTLVLFFLAEMGDKTQ
LATVALGARYADLLMVTMGTTLGMMAANVPAVLLGERLGQMFPLDKMRFVAAALFAVFGT
LILFKVNMGLGLAGL