Protein Info for DvMF_1404 in Desulfovibrio vulgaris Miyazaki F

Annotation: helicase, RecD/TraA family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 TIGR01448: helicase, RecD/TraA family" amino acids 11 to 721 (711 residues), 758.1 bits, see alignment E=3.8e-232 PF14520: HHH_5" amino acids 97 to 145 (49 residues), 27.1 bits, see alignment 2.5e-09 PF14490: HHH_4" amino acids 148 to 237 (90 residues), 112.7 bits, see alignment E=3.5e-36 PF13604: AAA_30" amino acids 327 to 506 (180 residues), 144.1 bits, see alignment E=2.5e-45 PF13245: AAA_19" amino acids 332 to 463 (132 residues), 159.7 bits, see alignment E=2.5e-50 PF18335: SH3_13" amino acids 569 to 630 (62 residues), 71.7 bits, see alignment 1.9e-23 PF13538: UvrD_C_2" amino acids 647 to 695 (49 residues), 68.7 bits, see alignment 1.7e-22

Best Hits

KEGG orthology group: K03581, exodeoxyribonuclease V alpha subunit [EC: 3.1.11.5] (inferred from 100% identity to dvm:DvMF_1404)

Predicted SEED Role

"RecD-like DNA helicase YrrC"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DRR5 at UniProt or InterPro

Protein Sequence (728 amino acids)

>DvMF_1404 helicase, RecD/TraA family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MQEAQDAPEQLSGVLDRVIFHNEENGYTVLRLRPLPKGDMISVVGHMVSPQPGASLKLVG
RWVNNPRFGRQFSMENYENLLPASVEGIRHYLGSGLIKGVGESMAARIVDAFGEDTFRVL
DEEPDRLLRVSGVGGKTLERIKAGWSDHQGIRDLIMFLQPHGVSTAYAVRIYRHYGQQAL
AVVRENPYRLAMDIHGIGFHTADTVAEKLGFSRDSELRAEAGTLYTLQRLNDDGHVYVPH
DALITHTSDQLDIRADLVEDALRTLEIEERIVIEEMDGELGVFLSRYHHYETKIAYYLQR
VLRSPKAVHFENPEAVIAEVLAKLSITLAPEQLEAVRTATRSKVMVLTGGPGTGKTTIIN
AIIKVFAETRAKILLAAPTGRAAKRMSETSGRESKTIHRLLEYSPKEDGFARNEDNPLAC
GLLVVDEASMMDTMLMYHLLKAVPLGATLLFVGDVHQLPSVGPGNVLRDVIASGVVPVVE
LVEVFRQAAESEIICNAHRINHGEVPPLESSRDRLSDFYFIRQDDPEKAVEMIVELVRDH
IPRRFGLHPVNDIQVLTPMHKGAVGAGNLNVRLQQALNGQTLCVQRGERQYRLDDKVMQI
RNNYDKDVFNGDIGRICLVDPKERQLTVRFDERNVPYAWEELDEIVPAYAISVHKSQGSE
YPAVVIPVLTQHYMLLQRNLIYTGVTRGKRLVVLVGEPRALAMAVKNNRMHKRHTRLARR
LALGVGVG