Protein Info for DvMF_1204 in Desulfovibrio vulgaris Miyazaki F

Annotation: FMN-dependent alpha-hydroxy acid dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF01070: FMN_dh" amino acids 35 to 178 (144 residues), 40.9 bits, see alignment E=2e-14 amino acids 206 to 338 (133 residues), 158.4 bits, see alignment E=4e-50 PF03060: NMO" amino acids 202 to 295 (94 residues), 31.9 bits, see alignment E=1.4e-11 PF01645: Glu_synthase" amino acids 258 to 297 (40 residues), 22.4 bits, see alignment 9.9e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1204)

Predicted SEED Role

"dehydrogenase, FMN-dependent family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKJ3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>DvMF_1204 FMN-dependent alpha-hydroxy acid dehydrogenase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKEVRDKARQLMKGYCRVCPVCNGKACSGEVPGMGGLGTGATFAANLDALAAVRLNMRLV
HDVKEPETTTTVCGIALDMPVLAAPIGGVSFNMGGGVSEEDYAAAVVGGCAERGIIGCTG
DGVPPFIIDAGFAAITGAGGRGIPFIKPWDGAELGEKLDRALELGCPAIGMDIDAAGLVT
LRKMGRPVGPKTPAELSRIVDKVKARGMAFILKGIMTTIDASLAVEVGADGIVVSNHGGR
VLDHAPGTAEVLPEIADAVKGRIAILADGGVRDGVDVFKMLALGADAVMLGRPFSIAAVG
GLKDGVTMLVDSIKGQLVQAMVLTGSANVASIGRHALRM