Protein Info for DvMF_1162 in Desulfovibrio vulgaris Miyazaki F
Annotation: ABC transporter related (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to BRAG_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraG (braG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to dvm:DvMF_1162)Predicted SEED Role
"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B8DKF4 at UniProt or InterPro
Protein Sequence (241 amino acids)
>DvMF_1162 ABC transporter related (RefSeq) (Desulfovibrio vulgaris Miyazaki F) MLLSIENLYVKYGNIEALHGLSFHVNEGEIVTLIGANGAGKSTTLKSIMRLPPPEAPKVS GGDILFKGKSLLNVEPHDVVSKLHVALVPEGRHIFGNLTVMENLMLATYARKNDPAISRD LERIFDLFPRLAERRTQRSDTLSGGEQQMLAVGRALMTSCEVLLLDEPSMGLAPLLMYEM FRTLKELNREGLTIIVVEQNARLALQVASRGYVLDTGEIVAQGPSESLLNDPEVKKAYLG G