Protein Info for DvMF_1103 in Desulfovibrio vulgaris Miyazaki F

Annotation: Tetratricopeptide TPR_2 repeat protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 58 (20 residues), see Phobius details PF13176: TPR_7" amino acids 73 to 100 (28 residues), 14.8 bits, see alignment 1.5e-05 amino acids 103 to 129 (27 residues), 15.7 bits, see alignment 7.9e-06 PF13432: TPR_16" amino acids 73 to 134 (62 residues), 40.4 bits, see alignment E=2e-13 PF13181: TPR_8" amino acids 74 to 96 (23 residues), 12.1 bits, see alignment (E = 0.00011) amino acids 102 to 129 (28 residues), 19.7 bits, see alignment 4.2e-07 PF13424: TPR_12" amino acids 101 to 168 (68 residues), 34.9 bits, see alignment E=8.5e-12 PF07721: TPR_4" amino acids 101 to 125 (25 residues), 17.1 bits, see alignment (E = 4.1e-06) PF07719: TPR_2" amino acids 102 to 133 (32 residues), 24.6 bits, see alignment 1.1e-08 PF13374: TPR_10" amino acids 107 to 129 (23 residues), 16.9 bits, see alignment (E = 3.1e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_1103)

Predicted SEED Role

"FIG00603510: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DK95 at UniProt or InterPro

Protein Sequence (189 amino acids)

>DvMF_1103 Tetratricopeptide TPR_2 repeat protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPHTTPLAVTPVSASASLGPVRSVGMPRPMFRCMSRPVSGAVLPCLLLTLLLTGCALPRI
GIYQDPLSGPEHLELGRAYEQKGELDLARREYAEAVRDDVPQAHLFLANLLFQKGELEEA
ESHYRKAIRSLPEAESAPARNNLAWLLLTRGERLEEAQRLAEEAVRLADDAHRQSFEDTL
NQVKAARNK