Protein Info for DvMF_1057 in Desulfovibrio vulgaris Miyazaki F

Annotation: methyl-accepting chemotaxis sensory transducer with Cache sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details PF08269: dCache_2" amino acids 58 to 232 (175 residues), 103.7 bits, see alignment E=2.1e-33 PF17200: sCache_2" amino acids 63 to 143 (81 residues), 49.5 bits, see alignment E=8.7e-17 amino acids 169 to 234 (66 residues), 42.3 bits, see alignment E=1.5e-14 PF00672: HAMP" amino acids 258 to 309 (52 residues), 34.1 bits, see alignment 5.5e-12 PF00015: MCPsignal" amino acids 416 to 599 (184 residues), 137 bits, see alignment E=1.2e-43

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to dvm:DvMF_1057)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPV4 at UniProt or InterPro

Protein Sequence (634 amino acids)

>DvMF_1057 methyl-accepting chemotaxis sensory transducer with Cache sensor (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPHPTPGPVPGTATPLSMSDSAAPRFEASVALRIIALATFIALLFMTAILGGFLPQVRSD
ALQARQQELQHLVQAALKLVEGLDAKAGRGEIPLDEARRRAADALRQMRYGNGDYFWIND
DRAPYPTMVMHPTAPVLEGQTLDKPAYNRGTHWRAAPGAPATEYPGGNRNLFQAFVDVAH
QHGEGLVAYMWPKPKQGGGVTDQTYPKESYIARYKPWGWIIGTGVYVDDLEVAAGRLRNM
VLAVTAAILAVGCVLTVLVTRSVRTPLHALVAYARAVAAGDLDAQPRGTFRAELRGLKQS
IASMVESLRMRIEEARARTDEAAEHARRAQAATAEAEAARIRAEQARRDGMHEAAGMLEG
IAAAIVDVADTVGRQVSLAGGGADAQKTRVAESSHAMERMDAAVAGMAGGAAGAADTADN
AQTKAREGAEGVQRVKEAVVRVEKGAASLHASMADLSRKADSIGGIMAVISDIADQTNLL
ALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMNATREVGEAIRAIQEGTAASARQVDAA
VEAVTQANAQADTAGSSLDEIVRLASGVSAQVRAVATSGQEQAAVSADIVRSLGDITTIS
EDTAQAMRDAERSLGDLNTEAQRLGDLVARFKEG