Protein Info for DvMF_1050 in Desulfovibrio vulgaris Miyazaki F

Annotation: Inositol-phosphate phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 39% identical to SUHB_NEIMB: Inositol-1-monophosphatase (suhB) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K01092, myo-inositol-1(or 4)-monophosphatase [EC: 3.1.3.25] (inferred from 100% identity to dvm:DvMF_1050)

Predicted SEED Role

"Inositol-1-monophosphatase (EC 3.1.3.25)" in subsystem Di-Inositol-Phosphate biosynthesis (EC 3.1.3.25)

MetaCyc Pathways

myo-inositol biosynthesis (1/2 steps found)
D-myo-inositol (1,4,5)-trisphosphate degradation (1/3 steps found)
superpathway of D-myo-inositol (1,4,5)-trisphosphate metabolism (1/6 steps found)
phytate degradation I (2/14 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.25

Use Curated BLAST to search for 3.1.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPU8 at UniProt or InterPro

Protein Sequence (279 amino acids)

>DvMF_1050 Inositol-phosphate phosphatase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MASSQPDSLVAFGGSLNLEDALAVALDAAKAGCAVLARGRSRLARVRTTTKSPGDITTEL
DARSEAAIFARIRQAYPDHARLGEESGDSTGDSGASPFRWIVDPLDGTVNYVHGIPYYAV
SVALEVNGVAVLGVVADPGRREFFTAVRGQGAFCNGRPVHVARRTRMDEAVVGTVVPPPK
WPGMEGYLEQFCAVARCAAGMRRGGAAALDLAYVAAGRLDGFFVVSLKRWDLSAGALLVR
EAGGAVADIDGHPDPLHANRLAAANSTLLPALLERLRSR