Protein Info for DvMF_1004 in Desulfovibrio vulgaris Miyazaki F

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF13561: adh_short_C2" amino acids 145 to 269 (125 residues), 61.3 bits, see alignment E=1.1e-20 PF00106: adh_short" amino acids 146 to 213 (68 residues), 41.4 bits, see alignment E=1.2e-14

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to dvm:DvMF_1004)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPQ2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>DvMF_1004 short-chain dehydrogenase/reductase SDR (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MVAAAGSPSPLRGPVLIAGGTCELGLALGAALAADGMAVTLTARDAAGAARIHAALPEAA
VLRLHAREPQRNAAGQDCSTPPAIDGAEAEDDTPETLPERARAALGEAPRLFVDLLHSRF
ECLLAGADPADIDLWAARDIAFRARLLRAVSRSMLAARDGRCVFVSSSAAERAAPGQGYY
AAAKLAGEALYRAVGVELAPRGVTACSLRLGWLEAGRGAPFLQSRAAGAPLPPTRRTVTV
TEAVQTLRFLLSAPATAINATTLTCDGGFGALKPAG