Protein Info for DvMF_0956 in Desulfovibrio vulgaris Miyazaki F

Name: murG
Annotation: undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 1 to 366 (366 residues), 295.5 bits, see alignment E=2.6e-92 PF03033: Glyco_transf_28" amino acids 4 to 142 (139 residues), 102.9 bits, see alignment E=1.6e-33 PF04101: Glyco_tran_28_C" amino acids 194 to 362 (169 residues), 127.2 bits, see alignment E=6.6e-41

Best Hits

Swiss-Prot: 100% identical to MURG_DESVM: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 100% identity to dvm:DvMF_0956)

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DP79 at UniProt or InterPro

Protein Sequence (382 amino acids)

>DvMF_0956 undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRRVILTTGGTGGHIFPALAVAEEITRRYPKARILFLGGQYGPEADLAARAGLEYVGLPV
RGVMGRGLRALAAAGAMGLGVWRAVSVVRRFDPDIAVGFGGYAAFAGVLAARLCGRPAAI
HEQNAIPGLTNRLLGHVVQRVFLSLPDTTGVFPARRCVPTGNPVRTAIVAAGAAGAAGAA
EKGGVSRSAHSRRLLVMGGSLGARAINEAVVAALPALRDAGVELWHQTGVADWERVRAGY
KQAGISEARVEAFIDDVASAYTWADLVLCRAGATSVAELAVAGKPSVLVPFPFATHNHQL
HNARHVADAGAALVVEQKDVSPGADGRPAVALDRVLVELLADRERLADMGRAARAMGRPQ
AAAAVVDGMEAILAGRGARGVR