Protein Info for DvMF_0920 in Desulfovibrio vulgaris Miyazaki F

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 249 to 275 (27 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 4 to 107 (104 residues), 24.6 bits, see alignment E=2.5e-09 PF00528: BPD_transp_1" amino acids 119 to 325 (207 residues), 132.8 bits, see alignment E=1.2e-42

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to dvm:DvMF_0920)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DP43 at UniProt or InterPro

Protein Sequence (343 amino acids)

>DvMF_0920 binding-protein-dependent transport systems inner membrane component (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MAAMLRRMARKLAWMLFVFWGITIISFWVIHLAPGSPTDMQTTMNPLAGAETRKRLEALY
GLDKPLHVQYVQWLGRLSRLDFGNSMSSDPRPVWDKIKERLPLTVGMNVASLVLTMLCAI
PIGVASAHWQGRLFDRAMTVLVFIGFAMPGFWLALLLMLLFGIHLQWLPLSGLTSLDHAA
MSPMGKAWDIMAHLAMPIFIYTFGSLAGLSRFMRASMLEVLRQDYILTARAKGLPVRTVI
FRHALRNALLPVITILGLSLPGLIGGSVIIESIFALPGLGQLFYQAVMARDYPLIMGNLV
LGAVLTLVGNLLADLCYGLADPRIRLTGGSGGDGAGNGDGGNA