Protein Info for DvMF_0861 in Desulfovibrio vulgaris Miyazaki F

Annotation: polar amino acid ABC transporter, inner membrane subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 56 to 152 (97 residues), 97.5 bits, see alignment E=2.8e-32 PF00528: BPD_transp_1" amino acids 78 to 257 (180 residues), 86.9 bits, see alignment E=7.3e-29

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to dvm:DvMF_0861)

Predicted SEED Role

"ABC-type amino acid transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNY5 at UniProt or InterPro

Protein Sequence (263 amino acids)

>DvMF_0861 polar amino acid ABC transporter, inner membrane subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTNEPQNVRIVITDGAIIPDPKERRIITAWSISFVGALAALVYLCASRPEPYWRLLQFLP
DGIAVTFKVTVLSILCSIPIGLITGLGRLSRNRLINLVASTYVEVVRGIPLLVQLFYIYY
ALGRFLKVPDLLAAIIALSVCYGAYMGEVFRAGIDSISKGQTEAARSLGFNRAETMFMVI
LPQAWRTILPPVGNEFIAMLKDTSLVSIIAVADILRRGREFASESFLYFETYTMVALIYL
LITLFLSKGVSIMESRLNYYDRR