Protein Info for DvMF_0833 in Desulfovibrio vulgaris Miyazaki F

Annotation: cobalamin biosynthesis protein CbiB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details PF03186: CobD_Cbib" amino acids 19 to 304 (286 residues), 289 bits, see alignment E=1.9e-90

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 100% identity to dvm:DvMF_0833)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DL86 at UniProt or InterPro

Protein Sequence (374 amino acids)

>DvMF_0833 cobalamin biosynthesis protein CbiB (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MDFLWGAWGAWGLLAVPPLALLLDLWLGDPRGLPHPVCGVGRMLRRAEAMARRHADGLPE
GERPAALRRAGVLAVMAVAGGVALAVWGLVRLPVLAPWLGALAAVYFAWAGLALGSLLRE
GRRTLHAIEHGTLDEARVAVSMLVSRDTAQLDRPDLRRALAETLAENFNDGFVGPLFWLL
LGGPAALWGYKAVSTMDSMWGYRTDRWRDLGRACARLDDVLAWLPARLSALVLWLSAPLV
LTDTGPDGARGGWQGFGPMARDARSMESPNAGWPMSAAAWLHGAPMGGPTPYFGVVKDKP
VLGPRPSWDVAGCTVADACGTASTSAPASAPACNPAPTWDAERLQGLLRHLRVAGLAATC
CLWAGALLLRVLVV