Protein Info for DvMF_0807 in Desulfovibrio vulgaris Miyazaki F

Annotation: Bile acid:sodium symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details PF13593: SBF_like" amino acids 12 to 324 (313 residues), 354.1 bits, see alignment E=7.7e-110 PF01758: SBF" amino acids 47 to 216 (170 residues), 51.7 bits, see alignment E=9.1e-18

Best Hits

Swiss-Prot: 45% identical to YFEH_ECOLI: Putative symporter YfeH (yfeH) from Escherichia coli (strain K12)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 100% identity to dvm:DvMF_0807)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DL60 at UniProt or InterPro

Protein Sequence (357 amino acids)

>DvMF_0807 Bile acid:sodium symporter (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MFAKYARRMAKDWFLAGMLGAVALATLLPGLGASGGTLHADMLGNAGIFLIFLFHGAGIS
PESMRHGMSRWKLHTMVQLTTFVVFPLLWFGFRFAFDALIPADLMLGFLYLCALPSTISS
SVAMTAIAHGNVPGAIFNATLSSLLGIFLTPVIIALAAGTQGGALSLTDAMINIAGLLFL
PFVLGQLARPWLGAFIARHKKKVNSFDKVAILILVYNSFCDSVLGGLWRDHGMDLLALTI
GGAALFLLVVLVLNTVVARALGFDKADEITAVFCGSKKTLASGVPMARLLFGAHPALGVI
VLPIMFYHQLQLFVCSILAERYARTMQQLEREGRDAAAVQAEEGEAAAPAAMEAVSR