Protein Info for DvMF_0805 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF6 transmembrane (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details PF00892: EamA" amino acids 2 to 125 (124 residues), 66.9 bits, see alignment E=1.1e-22 amino acids 151 to 284 (134 residues), 80 bits, see alignment E=9.8e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0805)

Predicted SEED Role

"FIG01289198: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DL58 at UniProt or InterPro

Protein Sequence (286 amino acids)

>DvMF_0805 protein of unknown function DUF6 transmembrane (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MVIVGSSVAAARFVSLTLPSHLVQELRFLVAACIAVPLLYRREGGLPRLPARDWGVLFLQ
AAAGSLLFNVLLLAGVARLDAAAAGVVTSTTPAVMALASLVLLRERPGPRTLAGIACCVA
GVLVLRLAPVPGAAGGDAALSLTASGADGVGLLLVLGAVCCETLFLLLGRTLRTPVSPLA
ASTACTLFGAVQFLPLALPQAHRVAELDVTGWLLVGYYGAVITVAAYIFWFRGVARVSAG
TAGAFTSVLPVSALAFSALLLGEPVGWAHLAGVACVLCGIWCVTRR