Protein Info for DvMF_0799 in Desulfovibrio vulgaris Miyazaki F

Name: thiH
Annotation: thiamine biosynthesis protein ThiH (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 TIGR02351: thiazole biosynthesis protein ThiH" amino acids 23 to 379 (357 residues), 441.2 bits, see alignment E=1.3e-136 PF04055: Radical_SAM" amino acids 84 to 236 (153 residues), 50.9 bits, see alignment E=2.2e-17 PF06968: BATS" amino acids 260 to 371 (112 residues), 63.4 bits, see alignment E=1.8e-21

Best Hits

KEGG orthology group: K03150, thiamine biosynthesis ThiH (inferred from 100% identity to dvm:DvMF_0799)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DL52 at UniProt or InterPro

Protein Sequence (414 amino acids)

>DvMF_0799 thiamine biosynthesis protein ThiH (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSMYDVVREWTPRVADAPLRAFMDAATPDGVARVLRKERLSPHDLLTLLSPAAATRLEAM
ALRARELTVRHFGRTIQFFTPLYLSNHCTNQCRYCGFNARNHIPRQRLTDEAIVAEGRAI
AATGLRHLLLLTGDARHVSGPDYIAHAARLLAPLFPSLSVEVYSLTDEEYALLVDAGIDG
MTMFQETYNEALYPELHPAGPKRDYHFRLDAPERAARAGMRSVGLGALLGLDDWRRDAFF
TALHGHWLQRRYPHVDVSFSVPRLRPHAGAFQPAYAVSDRDLVQVILAYRIFMPSAGITV
STRERAGLRDNLIPLGVTRMSAGVSTAVGGHAAHKNVEGQGDGDGATPQFEISDPRSADE
MASAIAARGYQPVYKDWESVLDGGYGCGIACAARRTPSGEPVGAPTPAAPRATA