Protein Info for DvMF_0689 in Desulfovibrio vulgaris Miyazaki F

Annotation: polysaccharide export protein, PEP-CTERM sytem-associated (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02563: Poly_export" amino acids 24 to 94 (71 residues), 86.3 bits, see alignment E=1.3e-28 TIGR03027: putative polysaccharide export protein, PEP-CTERM sytem-associated" amino acids 25 to 268 (244 residues), 226.5 bits, see alignment E=7.9e-72 PF10531: SLBB" amino acids 184 to 233 (50 residues), 32.7 bits, see alignment 5.2e-12

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 100% identity to dvm:DvMF_0689)

Predicted SEED Role

"FIG123464: Polysaccharide export protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DK50 at UniProt or InterPro

Protein Sequence (268 amino acids)

>DvMF_0689 polysaccharide export protein, PEP-CTERM sytem-associated (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKYFAGIVAVVAVLVCASAGYSFEYVVGYGDVINVNVWGEKDLSVKVTVRPDGKVTLPGV
GDVEAAGQTPEQLQTKIAAKYAEIVRNPVVTVSVDTSQNNSVVVHGPGVKPGMVPLVGRT
TLLQVLTRVAPEATADLDGATLSRGEDVLRTGFRDLYERGVASDDVELKPGDRVFIPFRS
KWAVYVVGAVNTPKTIAHHDGMTLLEALLAAEGFTRFADRNRTEVVRAHDGRPEVIVVRA
GDLVDKGDLSQNVLLQAGDYVIAKKGMF