Protein Info for DvMF_0657 in Desulfovibrio vulgaris Miyazaki F

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 78 to 99 (22 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 159 to 184 (26 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 89 to 284 (196 residues), 55.6 bits, see alignment E=3e-19

Best Hits

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to dvm:DvMF_0657)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DK18 at UniProt or InterPro

Protein Sequence (297 amino acids)

>DvMF_0657 binding-protein-dependent transport systems inner membrane component (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPPAFRSHATMRTIHAWLLLLPALAFIAAFTHYPAVNTFIHSFFLDGRGGAPAQFVGLEH
YQYLLEDEVFRKALVNNLLFASGTIPLSIGLAMTMAFLVNAGLAGQSVLRLCYFVPTVLP
MIAVANIWLFFYTPEYGLLEQIRGALGLAGVNWLGSESTALPCVIAVAVWKDAGFFMIFY
LAALQQIPPSLGEAAMLEGASRLYYYRRVVIPLLMPTTLFVLVNATINAFRMVDHLFVLT
QGGPNNASSLLLYYIYEVSFKYWDTGYGAALTMVLLGFLALASIGQFGFLDRKVHYR