Protein Info for DvMF_0603 in Desulfovibrio vulgaris Miyazaki F

Annotation: 2-oxoglutarate ferredoxin oxidoreductase subunit alpha (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01855: POR_N
  • amino acids 23 to 250 (228 residues), 236.6 bits, E=4.7e-74
• PF02780: Transketolase_C
  • amino acids 282 to 347 (66 residues), 26.5 bits, E=8.2e-10
• PF17147: PFOR_II
  • amino acids 283 to 377 (95 residues), 94.3 bits, E=7.7e-31

Best Hits

Swiss-Prot: 52% identical to KORA_METTH: 2-oxoglutarate synthase subunit KorA (korA) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00174, 2-oxoglutarate ferredoxin oxidoreductase subunit alpha [EC: 1.2.7.3] (inferred from 100% identity to dvm:DvMF_0603)

Predicted SEED Role

"2-oxoglutarate oxidoreductase, alpha subunit (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

• reductive TCA cycle I (9/11 steps found)
• incomplete reductive TCA cycle (6/7 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• reductive TCA cycle II (7/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

See B8DJW4 at UniProt or InterPro

Protein Sequence (382 amino acids)

>DvMF_0603 2-oxoglutarate ferredoxin oxidoreductase subunit alpha (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MAVQRKKRKRRELFALGNEAVAEGALLAGCSFYAGYPITPSTEIMEVMANRLPLIEDGVF
IQMEDEIASMGATIGASLAGRKAMTATSGPGFALMQEHIGYACMVEAPLVVVNVMRGGPS
TGLPTSPAQADVQMARWGTHGDHPIIVLSASNVQECLEMTVTAFNFAEKYRTPVILLLDE
VTAHTREKITVPDPDEVEILSRVEPTVPPEWFKPYADTARGVPAMAPIGSGYRTHVTGLT
HDVMGYPTQRPDEVKDAMLRLFRKIDQYYGDIQMSDEYMLDDAEVAVVAYGSVARSAHLA
VEQARERGAKAGLLTLKTLFPFPRPAVEKLTHRCHTVVVPEMNMGQMSREVKRVNNGRTK
VRTINRVDGQIITPSEILKAIL