Protein Info for DvMF_0599 in Desulfovibrio vulgaris Miyazaki F

Annotation: HAD-superfamily hydrolase, subfamily IIA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00702: Hydrolase" amino acids 7 to 222 (216 residues), 50 bits, see alignment E=7.4e-17 TIGR01460: HAD hydrolase, family IIA" amino acids 9 to 231 (223 residues), 122.6 bits, see alignment E=1.2e-39 PF13344: Hydrolase_6" amino acids 9 to 103 (95 residues), 60.1 bits, see alignment E=2.7e-20 PF13242: Hydrolase_like" amino acids 183 to 252 (70 residues), 75.2 bits, see alignment E=4.8e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0599)

Predicted SEED Role

"Hypothetical NagD-like phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJW0 at UniProt or InterPro

Protein Sequence (255 amino acids)

>DvMF_0599 HAD-superfamily hydrolase, subfamily IIA (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MNLDQKRCIIFDLDGTVYLGDRPIPGTVDFIRRNLGVRDIQFLTNNTSKNLADYTAKLAG
MGIDIGLDRMLSPLLPLVDHLREQSISRVYPVGNANFTAFLRERMPDIVFTAGDDCQAVL
LGYDTELTYRKLTESCLLLQRPDVAFLATHADRVCPSPQGPLPDAGSFMALYEAATGRTP
DIVFGKPNTILLRSLLQRYQPHEMVMVGDRIYTDKLLAENAGMDFILVLSGETRREDLAS
LSRQPALVVDDLGGY