Protein Info for DvMF_0594 in Desulfovibrio vulgaris Miyazaki F

Annotation: intracellular protease, PfpI family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 7 to 170 (164 residues), 157 bits, E=2e-50
• TIGR01382: intracellular protease, PfpI family
  • amino acids 9 to 171 (163 residues), 159.9 bits, E=2e-51

Best Hits

Swiss-Prot: 50% identical to DEGLY_PYRHO: Deglycase PH1704 (PH1704) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 100% identity to dvm:DvMF_0594)

MetaCyc: 50% identical to archaeal arginyl aminopeptidase monomer (Pyrococcus horikoshii OT3)
RXN-23973 [EC: 3.4.11.27]

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.- or 3.4.11.27

Sequence Analysis Tools

See B8DJV5 at UniProt or InterPro

Protein Sequence (174 amino acids)

>DvMF_0594 intracellular protease, PfpI family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MQRLKGKRVLMFVDDVYEDLELWYPKLRLIEEGAEVVVAGPEKGRTYTGKNGYPCKADAA
IADMEDISFDLLVISGGFAPDKLRRDPKVLELTRRMHEAGKMVAHICHAGWIPISAGIMR
GFRCTSTPGIKDDLINAGAIWEDAEVVVDRNQVSSRKPDDLPAFCKAIIALAAG