Protein Info for DvMF_0567 in Desulfovibrio vulgaris Miyazaki F

Annotation: ATP-dependent chaperone ClpB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 862 PF02861: Clp_N" amino acids 5 to 122 (118 residues), 107.7 bits, see alignment E=3.4e-34 TIGR03346: ATP-dependent chaperone protein ClpB" amino acids 6 to 861 (856 residues), 1396.6 bits, see alignment E=0 PF23569: NBD_SMAX1" amino acids 191 to 292 (102 residues), 33.7 bits, see alignment E=2.5e-11 PF00004: AAA" amino acids 208 to 324 (117 residues), 44.7 bits, see alignment E=1.3e-14 amino acids 606 to 724 (119 residues), 34.9 bits, see alignment E=1.4e-11 PF17871: AAA_lid_9" amino acids 347 to 449 (103 residues), 120.5 bits, see alignment E=2e-38 PF07724: AAA_2" amino acids 600 to 766 (167 residues), 236.8 bits, see alignment E=9.6e-74 PF07728: AAA_5" amino acids 605 to 726 (122 residues), 50.7 bits, see alignment E=1.3e-16 PF10431: ClpB_D2-small" amino acids 774 to 852 (79 residues), 94.3 bits, see alignment E=2.6e-30

Best Hits

Swiss-Prot: 85% identical to CLPB_DESVH: Chaperone protein ClpB (clpB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03695, ATP-dependent Clp protease ATP-binding subunit ClpB (inferred from 82% identity to dde:Dde_1661)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKU5 at UniProt or InterPro

Protein Sequence (862 amino acids)

>DvMF_0567 ATP-dependent chaperone ClpB (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MDINKFTEKSQQAIAEAQSTAVRLGHQQVDVEHAALALVRQEQGLVPRLLERAGYKPDAF
AGALEAALQKRPAVSGPGAAQGQIYVTQRLNQALVRAQDFAKRLKDEYVSVEHLICAFLE
EPPSTDMGRVAREFGLTQDKLLAVLEDVRGAQRVTSQNPEDTYEALQKYGRDLVEEARKG
KLDPVIGRDAEIRRVVRILSRRTKNNPVLIGEAGVGKTAIVEGLAHRILKGDVPEGLKNR
SLFALDMGALIAGAKYRGEFEERLKAVLKEVEKAEGRIVMFIDELHTIVGAGKTDGAMDA
GNLLKPMLARGELHCIGATTLDEYRKYIEKDPALERRFQPVVVDEPTVEDTISILRGLRE
RFEVHHGVRISDSAIVEAVTLSHRYITDRQLPDKAIDLIDEAAALIRTEIDSLPAELDEV
NRKVMQLEIEREALRRETDAASRERLEKLENELADLRASQATLLAQWEREKGSIDAVRTI
KEEIERTRLAIDEAERNYDLNRAAELKYSKLLELERKLAAAERGDDENRLLKEEVRPDDV
AEIVARWTGIPVTRLLESEREKLLRLGDVLHERVVGQDEAVQAVAEAVLRARAGLSDPGR
PIGSFIFLGPTGVGKTELCKTLAESLFDSEDNIVRIDMSEYMEKHAVARLIGAPPGYVGY
DEGGQLTEAVRRKPYSVVLFDEIEKAHADVFNVLLQILDDGRLTDSHGRTVDFKNTIIIM
TSNIGSSHLLDGITDEGEFRPGVRDRVMDEMRRHFRPEFLNRVDEIVMFRPLLPEQIGRI
VELLLGKLRGRLAERKITVDLSDAARDFIAESAYDPVYGARPLRRYLQTNVETPLARRLI
AGDLKDGQHVTIGVRVDKLTFE