Protein Info for DvMF_0551 in Desulfovibrio vulgaris Miyazaki F

Annotation: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 11 to 623 (613 residues), 804.5 bits, see alignment E=3e-246 PF01134: GIDA" amino acids 12 to 400 (389 residues), 531.6 bits, see alignment E=1.9e-163 PF21680: GIDA_C_1st" amino acids 465 to 558 (94 residues), 63.7 bits, see alignment E=3.3e-21 PF13932: SAM_GIDA_C" amino acids 561 to 627 (67 residues), 68.4 bits, see alignment E=7.2e-23

Best Hits

Swiss-Prot: 80% identical to MNMG_DESVH: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 100% identity to dvm:DvMF_0551)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKS9 at UniProt or InterPro

Protein Sequence (633 amino acids)

>DvMF_0551 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPRKAPFPALFDCIVVGAGHAGCEAAMASARLGHPTLLLTSNADRIGHLSCNPAIGGLAK
GHMVKEIDALGGMMGLWADEAGIQFRTLNVSKGPAVRATRAQIDRDAYLHAVRRDVFAQD
NLWVWQDTAEAILAEQGRAAGVRTGLGQEFRARTVLLTTGTFLCGLIHVGLTNFPGGRLG
DAPAVGLSASLRTHGLELGRLKTGTTPRLLRASIDFSVMEEQPGDEPPRPFSFRGPGVRL
PQVPCYMTWTNERTHAAIRAGFDRSPMFTGVITGTGARYCPSIEDKVARFPDRERHQIFV
EPEGLTSPECYPNGIPTSLPLDVQKAMIATIPGLENAQIVRPGYAIEYDYADPIQLHPTL
ETKTLPGLYLAGQINGTSGYEEAAAQGLWAALNASCALRGLPPFLPGRDAAYMAVLVDDL
VTKGTREPYRMFTSRAEHRLLLRENNADARLTPLGRDLGLVDDGHWAVFRARHDALADLM
TELEQRRVTPDAATRAVFADLGEAVPTRAVSLAELLRRPTMSLERLRAFWPEATDHAPEV
REEAETIIRYSGYLARQEELVERAARQESQPLPEGLDYTAVAGLTREIVEKLTRVQPRTM
GQAARISGVTPAALTCIEIHLRKLERSQASPVG