Protein Info for DvMF_0548 in Desulfovibrio vulgaris Miyazaki F

Annotation: Guanine deaminase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF01979: Amidohydro_1" amino acids 61 to 408 (348 residues), 228.5 bits, see alignment E=1.4e-71 PF07969: Amidohydro_3" amino acids 197 to 410 (214 residues), 66 bits, see alignment E=4.7e-22

Best Hits

Swiss-Prot: 100% identical to MTAD_DESVM: 5-methylthioadenosine/S-adenosylhomocysteine deaminase (mtaD) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K12960, 5-methylthioadenosine/S-adenosylhomocysteine deaminase [EC: 3.5.4.- 3.5.4.28] (inferred from 100% identity to dvm:DvMF_0548)

Predicted SEED Role

"S-adenosylhomocysteine deaminase (EC 3.5.4.28); Methylthioadenosine deaminase" (EC 3.5.4.28)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.- or 3.5.4.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKS6 at UniProt or InterPro

Protein Sequence (440 amino acids)

>DvMF_0548 Guanine deaminase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTRPCDILIQAACIVTQDAMRTVVEDGALAVADGTVLAVGPREAVTAAHAPARLLDLGNA
LVMPGLVNAHTHAAMTFLRGVADDLPLMDWLTQHIFPVEKHLTPDIVEAGALLGCAEMLR
TGTTAFNDMYLIQDATYRAVDTAGLRCLGGEGIFGFPSPAYPDADAGLDLVRRLHETWRH
NPRIRQCVTPHAVYTTSPELLQRCQALAEELDLPLHIHLAETTTETAQCQQMFGQRPVPY
CHGLGLLTPRATVAHAVDLTDDEMDLLASTGAAVAHNPESNMKLASGAAPVPQMLARGIA
VGIGTDGAASNNSLNMFTEMTSCAMLHKLRCMDPTCAPAQTVLDMATLGGAAALHWPGLG
QLAPGCPADLTVLDLSAPNLQPMYNPASHLVYAATGHEVRLTMVAGEVLYQDGRFTRFDY
PALMAQMRDVRRWVLDKLGR