Protein Info for DvMF_0535 in Desulfovibrio vulgaris Miyazaki F

Annotation: cytochrome c oxidase subunit III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details PF00510: COX3" amino acids 3 to 195 (193 residues), 54.6 bits, see alignment E=7.6e-19

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to dvm:DvMF_0535)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKR3 at UniProt or InterPro

Protein Sequence (198 amino acids)

>DvMF_0535 cytochrome c oxidase subunit III (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHEHRDYEGAKIGMWLFLFTEVLLFGGLFLLYAVYLHRYPAEFHAAGKDLSRIFGTANTI
VLITSSLCMALAISALQRGKVVLSQRLVLLTVTMAGVFLVNKFFEWSAKIGHGIYPDSPA
LLKLPPGEMVFFNLYYLMTGLHGIHVIIGAAVLMYGWHLMRVGRVTPEHFVFLENGGLYW
HLVDLVWIYLFPLFYLVV