Protein Info for DvMF_0534 in Desulfovibrio vulgaris Miyazaki F

Annotation: caa(3)-type oxidase, subunit IV (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details TIGR02229: caa(3)-type oxidase, subunit IV" amino acids 8 to 96 (89 residues), 108.8 bits, see alignment E=8.9e-36 PF03626: COX4_pro" amino acids 18 to 86 (69 residues), 56.7 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0534)

Predicted SEED Role

"Cytochrome c oxidase polypeptide IV(EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKR2 at UniProt or InterPro

Protein Sequence (96 amino acids)

>DvMF_0534 caa(3)-type oxidase, subunit IV (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTGHDTEHHAVPVRTNMLVWAALMMLTAITVGVTSFDFGFLNVVVALSVATIKAGLVILW
FMHLRYEGRVIRLMVFTAFVILAIAIGFTFFDVAYR