Protein Info for DvMF_0522 in Desulfovibrio vulgaris Miyazaki F

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 22 to 161 (140 residues), 105.6 bits, E=1.7e-34

Best Hits

Swiss-Prot: 52% identical to Y412_METJA: Uncharacterized ABC transporter ATP-binding protein MJ0412 (MJ0412) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to dvm:DvMF_0522)

MetaCyc: 44% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

See B8DKQ0 at UniProt or InterPro

Protein Sequence (249 amino acids)

>DvMF_0522 ABC transporter related (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MIECRNVSKTFIQKGKQEVPVLEDVSLDVQANEFVVILGPGQSGKSTLLRIIAGLETPTT
GTVTLDGEPVTGPGADRGLVFQGYMLFPWKTVLGNVEMGPKLCGLPGDEARDIALHYIDL
VGLKGFEKHYPHQLSGGMKQRVGIARAYANKPRVMLLDEPFGQLDAQTRIFMEQETERIW
QTDKRTVLFVTNNTDEALFLADRIVTIEGKLPGRVQRTYTVDLPRPRDLTGKHFLEMRRE
IIDASVLTL