Protein Info for DvMF_0492 in Desulfovibrio vulgaris Miyazaki F

Annotation: multicopper oxidase type 2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details PF07732: Cu-oxidase_3" amino acids 160 to 229 (70 residues), 52.6 bits, see alignment E=4.9e-18 PF07731: Cu-oxidase_2" amino acids 519 to 642 (124 residues), 78.1 bits, see alignment E=5.7e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0492)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DKM0 at UniProt or InterPro

Protein Sequence (645 amino acids)

>DvMF_0492 multicopper oxidase type 2 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSTKGYCKNARPPRTDAPLRLSRRDFLLLSGGAALVLGIASGLPPWLGGVRAETPRLMSG
GPLPLPGQSGLFGLFAPTGPFTLSAMPQAGLLPATGGPMLAYTTEQQGRVYHNPVLVLDK
GQDFAVRLVNGLGPLGPMPAGHGAHASHGGSAGAAPSGPDTIIHWHGVDCPWQQAGHPMY
AVGPDAHYDYAFPITNRAGTYWYHPHPHGDTARQAYLGLASFFIVRDDEERAFARELDLT
LGTTDIPLVLQDKRIGQAGELVYAPTQDELFMGYLGDRVLVNGAHLPTLSASTRLYRFRL
LNGSTARIFNLAFTGGSAGKAGARVPVTVIANDGGFLPAPRRVDGLFLAPGERAEVLLDL
RDMEPGEQVWLRNLPFDPMHNEMEHGSDGAGHGAGHGAAGDAHIGVAAAPGAMDGMEMGH
DGSMHHGMNRATMPAVTAPPVRQGGQHAGHGGAPMGSGAHGESDGLAEGGDYPILKVSVD
RPERYDRKVPERLPAQDEPVPATDGQSAFTRALRLEADGKRWTIAGETFAMDRFPITVPE
RRREAWAMENAVRSMPHPMHLHGYFLRVRARQGSPAQVRALAVDGTGRLPTDLGLKDTVL
VWPGETVLADVDFRSPAYPGEQIFLFHCHNLEHEDQGMMVNVRLP