Protein Info for DvMF_0474 in Desulfovibrio vulgaris Miyazaki F
Annotation: acetyltransferase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 41% identical to Y2212_CHLTE: Uncharacterized N-acetyltransferase CT2212 (CT2212) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
KEGG orthology group: K00619, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 100% identity to dvm:DvMF_0474)Predicted SEED Role
"GCN5-related N-acetyltransferase"
MetaCyc Pathways
- L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
- L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
- L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
- L-ornithine biosynthesis I (5/5 steps found)
- superpathway of arginine and polyamine biosynthesis (10/17 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.1
Use Curated BLAST to search for 2.3.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B8DKK2 at UniProt or InterPro
Protein Sequence (155 amino acids)
>DvMF_0474 acetyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F) MGQPYIRKARVQDVKPIHALLMHTSGQGLLLPRSLNQLYSHLRDFLVIDPDDGGPLVGCC ALSIAWDDIAEVRSLVVADDLRGKGWGRKLVDACLSDAVTLGIFRVFALTYQVEFFLRMG FRVVEKDVLPQKIWADCIHCPKFPDCDETAVLLEM